PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.9375s0006.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family LFY
Protein Properties Length: 421aa    MW: 46426 Da    PI: 7.3137
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.9375s0006.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY625.87.4e-19113901386
              FLO_LFY   1 mdpeafsaslfkwdpraaaaapparlleeaavseapleaaaaaaarklreleelfkayGvryltvakiaelGftvstLvdmkdeelddlm 90 
                          mdpe f++ lf+w+p  a +++p  + +  +++  p++ ++aa  ++l +le lf ayG+r++t+akiaelGft+stLv+mkdeel+++m
  Araha.9375s0006.1.p   1 MDPEGFTSGLFRWNPTRALVQAPPPVPPPPQQQ--PATPQTAAFGMRLGGLEGLFGAYGIRFYTAAKIAELGFTASTLVGMKDEELEEMM 88 
                          9*************7666655555555444333..33356677788889***************************************** PP

              FLO_LFY  91 kslseifrldllvGeryGikaavraerrrleeeea.ekkrrkll.....sedeetaldalsqeglseepvqeekeaagsggeglgeaelv 174
                          +sls+ifr++llvGeryGikaavraerrrl+eee+ +++rr+ll      + +++aldalsqeglseepvq++ ++ ++g++g g ++  
  Araha.9375s0006.1.p  89 NSLSHIFRWELLVGERYGIKAAVRAERRRLQEEEEeSSRRRHLLlsaagDSGTHHALDALSQEGLSEEPVQQQDQTDAAGNNGGGGSGYW 178
                          ******************************9965515566676678844344556****************9777666666665666666 PP

              FLO_LFY 175 aaeekkseeekkkaskkkqkrkkkkelkseededeeeeededeeg.....sgedgeerqrehPfivtepgevargkknGLDYLfdLyeqC 259
                           a ++k    kk++ + +++rkk   ++ e+d+d +e ed+d+++     +g  g+erqrehPfivtepgevargkknGLDYLf+LyeqC
  Araha.9375s0006.1.p 179 EAGQAK---MKKQQ-Q-QRRRKKPMVTSVETDDDVNEGEDDDGMDngnggGGGLGTERQREHPFIVTEPGEVARGKKNGLDYLFHLYEQC 263
                          665322...23333.2.233333333344455555555555544412222444566********************************** PP

              FLO_LFY 260 refLlqvqkiakerGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaa 349
                          refLlqvq+iak+rGekcPtkvtnqvfryakk+gasyinkPkmrhYvhCYalhcLde+asn+lrrafkergenvG+wrqacykplv+ia 
  Araha.9375s0006.1.p 264 REFLLQVQTIAKDRGEKCPTKVTNQVFRYAKKSGASYINKPKMRHYVHCYALHCLDEDASNTLRRAFKERGENVGSWRQACYKPLVNIAC 353
                          ****************************************************************************************** PP

              FLO_LFY 350 rqgwdidavfnahprLsiWYvPtkLrqLChlerskas 386
                          r+gwdidavfnahprLsiWYvPtkLrqLChler++a+
  Araha.9375s0006.1.p 354 RHGWDIDAVFNAHPRLSIWYVPTKLRQLCHLERNNAV 390
                          *********************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016983.0E-2021389IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 421 aa     Download sequence    Send to blast
MDPEGFTSGL FRWNPTRALV QAPPPVPPPP QQQPATPQTA AFGMRLGGLE GLFGAYGIRF  60
YTAAKIAELG FTASTLVGMK DEELEEMMNS LSHIFRWELL VGERYGIKAA VRAERRRLQE  120
EEEESSRRRH LLLSAAGDSG THHALDALSQ EGLSEEPVQQ QDQTDAAGNN GGGGSGYWEA  180
GQAKMKKQQQ QRRRKKPMVT SVETDDDVNE GEDDDGMDNG NGGGGGLGTE RQREHPFIVT  240
EPGEVARGKK NGLDYLFHLY EQCREFLLQV QTIAKDRGEK CPTKVTNQVF RYAKKSGASY  300
INKPKMRHYV HCYALHCLDE DASNTLRRAF KERGENVGSW RQACYKPLVN IACRHGWDID  360
AVFNAHPRLS IWYVPTKLRQ LCHLERNNAV AAAAALVGGI SCTGSSTSGR GGCGGDDLRF  420
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A1e-1442274201194PROTEIN LEAFY
2vy2_A1e-1442274201194PROTEIN LEAFY
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ4471030.0DQ447103.1 Arabidopsis thaliana clone pENTR221-At5g61850 floral meristem identity control protein LEAFY (At5g61850) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_200993.10.0protein LEAFY
SwissprotQ009580.0LFY_ARATH; Protein LEAFY
TrEMBLA0A023T4L80.0A0A023T4L8_ARATH; Protein leafy
STRINGAT5G61850.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79072841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.10.0floral meristem identity control protein LEAFY (LFY)